SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|187709|estExt_GeneWisePlus_worm.C_20314 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|187709|estExt_GeneWisePlus_worm.C_20314
Domain Number 1 Region: 54-181,214-300
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-29
Family Glycosyl hydrolases family 16 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|187709|estExt_GeneWisePlus_worm.C_20314
Sequence length 333
Sequence
MLFLSTLFLALLPLGALAGKHQDKSLRSRHANHARTLHVRNNTKTFVLQDMYTGQSFLND
WDFFSDPDPTHGSVNFQTKDQAIAKNLAFVQSDGTTVLAVDDTSALPPNSNRDSIRITSK
KTYNGGLFIADFWAMPHGCSVWPAYWSVGPNWPSAGEIDVLEGVHNQPTNQYTLHTGPGC
TLNSDNNRVSANAISSQCASSGDNNNGCAFIDTDTRSYGKPFNMIGGGVYAHLWNSEGIK
MWHFARGEIPADINAKQPNPASWPTPAAFWSAKSCNMNGFHDHQLVIDTTLCGDFAGATY
ASAGCPGTCGGAVQNPANFRFAKWKINYIATYQ
Download sequence
Identical sequences B0CTZ7
XP_001875146.1.58555 jgi|Lacbi1|187709|estExt_GeneWisePlus_worm.C_20314 29883.JGI187709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]