SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|242154|e_gwh1.242.1.1 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|242154|e_gwh1.242.1.1
Domain Number 1 Region: 73-202
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.09e-27
Family Glutathione S-transferase (GST), C-terminal domain 0.00086
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.18e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|242154|e_gwh1.242.1.1
Sequence length 210
Sequence
MVLKLYGFHLSTCTQTVATVLYEKNVPFEFIPVDISKGEQKAPEYLVIQPFGQVPYIDDD
GYIVYESRAIARYIAAKYADQGTPLLPKDPKAYGLSEQAASIEAFNFHPHASKPLPKTYR
GLTSDPAVYEAAISALDKHLDVYDTILAKQKYLAGDEITLADIFHVAYGSYLPAAGSNVI
ESKPNVDRWFKEVSGRASWQVVKDGVKSTA
Download sequence
Identical sequences B0E468
jgi|Lacbi1|242154|e_gwh1.242.1.1 XP_001890985.1.58555 29883.JGI242154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]