SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|292728|estExt_fgenesh2_pg.C_40252 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|292728|estExt_fgenesh2_pg.C_40252
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000878
Family DsbC/DsbG C-terminal domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|292728|estExt_fgenesh2_pg.C_40252
Sequence length 205
Sequence
MALQPSLRQLIVAGSHDAPHTLDIFLDYVCPFSAKMALTIDNVLKPFFSKGGKYDGKVKA
VFRLQVQPWHATSTLTHEAGLGVLRASPENFWPFSLLLFKNQTDYFDIPASTLTPIQIRE
KLALLAAEIIPADAVEQVKDLLTLKGSPNGGVAVTDDLKYNIKFSRQNSIHVSPTVLWDG
LVAQEISSSWGEKEWTAFLESKVLV
Download sequence
Identical sequences B0CZY5
29883.JGI292728 jgi|Lacbi1|292728|estExt_fgenesh2_pg.C_40252 XP_001876497.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]