SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|312756|eu2.Lbscf0054g00810 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|312756|eu2.Lbscf0054g00810
Domain Number 1 Region: 397-472
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000173
Family UBX domain 0.05
Further Details:      
 
Domain Number 2 Region: 199-288
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000403
Family Thioltransferase 0.056
Further Details:      
 
Weak hits

Sequence:  jgi|Lacbi1|312756|eu2.Lbscf0054g00810
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.0638
Family UBA domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|312756|eu2.Lbscf0054g00810
Sequence length 582
Sequence
MDYLSTGQQQALAQLREIINGADDDVAIGVLSSVDWDVPRAAELIFGSTSTSAVSDRIID
TFEIDDTHQSIPERQPSTSVLATLTRPVFSFLAFPFHVLSNVFRFIFAILRIPFPSLRFT
SLNFYRPLRPRPTFRRGPDSWLRELEEETGAVSIGRLKLPRGTTSSIGLDAGPSSLTSRA
AAGNSGSGNGFTEDGRKVLPDFVLRGYEETLRMCQRDAKIACIVLVSEEHDDVAEFKRST
LTDAAFVKSLYDNGIVVWGGDVRDQDAWSAAEKLQATTYPFVAFIALQPGRTPSSSSSPR
TSAPPTLTVLSRHQGRSVPSSAPTSAQTLLNHLEQQVIPRVTPFLERLRATQRDRERDRQ
LRQDQDRAFRDSAQRDKERIEAAIRAESAQQQARIQAEEEERERRRQAEVEKQKEVVRMG
WRRWTRRVFASEQRKSGSLRVAIRLPSGGRFVHQFEGSATLTTLYALVDAQLIPGEFESR
DDPLSPPDLDGVEGGRLALLETQVESYQSPTEYWGFLVVSAYPRVEIPWRKGVLLGTIEQ
LRGGGQVVVELTQNGLAGSRRSSSEHVPSSSVDDGYSTEDSE
Download sequence
Identical sequences B0DWL8
XP_001888398.1.58555 29883.JGI312756 jgi|Lacbi1|312756|eu2.Lbscf0054g00810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]