SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lacbi1|325848|fgenesh3_pg.C_scaffold_8000342 from Laccaria bicolor S238N-H82

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lacbi1|325848|fgenesh3_pg.C_scaffold_8000342
Domain Number 1 Region: 22-125
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-25
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 161-217
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000235
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lacbi1|325848|fgenesh3_pg.C_scaffold_8000342
Sequence length 464
Sequence
MPATSTLDADDKSKVKAAVPISSNKIIFAALSRIYYAYPQPDKWSYAGLQGGLVFARDTH
KNILYFRLVDLDGTRGVIWEHELYEGLEYSQDRGFFHSFAGDKCMIGFVFAEEHEAKIFY
KKVMMKKDAKAKKNTSKPKKLSISKGGRVDKSMISGPQAGSFKHIAHMGYDAEAGFTSKG
VDPSWTTFLGNLENSGVDKAIIEENMEFIKNFTARNHHPPENHHLPESLLPENHQLPESL
LQLQPRYSHHHHHAAQRPHKHKPTTRHHLPLPGLQADSPTGPLRPLHVPPYHPLQNQQYL
PQHVQPYRPPHAQPSLHVVLPRLRVRPPIFHLAVRLLPLSHLLLQMVHHHRRRLLLRRLR
WEVPGRGDLLASIKGAGIHQLKKADPNANANAGPPSAGGGGRAVPSRIAPLEPQDTGTTT
ATGTTGSGSGGGDLTSALAAALLERNKRLGDSDDDEDDDDEDWD
Download sequence
Identical sequences B0D6F6
XP_001879567.1.58555 29883.JGI325848 jgi|Lacbi1|325848|fgenesh3_pg.C_scaffold_8000342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]