SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Treme1|72246|estExt_fgeneshTM_pm.C_110131 from Tremella mesenterica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Treme1|72246|estExt_fgeneshTM_pm.C_110131
Domain Number 1 Region: 22-132
Classification Level Classification E-value
Superfamily PH domain-like 9.14e-27
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 167-270
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000000562
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Treme1|72246|estExt_fgeneshTM_pm.C_110131
Sequence length 459
Sequence
MAPTPLLSADDKVKVKKAIPTSGSSNKIVTAAVARVYTAKEGARTWTYANAEGALVFCAD
KSKGGLWFRVVDLSSSRGVIWEHELPNEIEYNQEKPFFHSWQGDSTSIAFVFASEAEAGD
FYKKVANRSKYATKVKEEKKEKEKTPTKKKKGGKIDKSQISGPSAGSFKHLAHMGYDAEK
GFSSVGVDPSWQALLEQLSAKGISAKDIQKNEKFIKDFVEQQGGIQKATATARKPPPPPA
PTSRRKAAPPPPASRARPTSVVTSPPPPPPPPPPPSLPPSRSHPSSTPSAPPPPPSAPPR
ATPSAPPPPAPPRATPGPPPPPPPPPPPSGGRIPPPPPRAPPVASGPPPPPPPSPPQASS
PSAPAGRSALLASIQGQGIHALRKVDPDQQHVSPLAGGSAVAAGAGAAVVGAGAAAAVAS
AAGPEDGPDLASSLAAALARRKGDLGDSDEEEESEGEWD
Download sequence
Identical sequences jgi|Treme1|72246|estExt_fgeneshTM_pm.C_110131 XP_007006948.1.33187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]