SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383781319|ref|YP_005465886.1| from Actinoplanes missouriensis 431

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383781319|ref|YP_005465886.1|
Domain Number 1 Region: 9-179,273-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.13e-45
Family Bacterial dinuclear zinc exopeptidases 0.011
Further Details:      
 
Domain Number 2 Region: 167-269
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.54e-19
Family Bacterial exopeptidase dimerisation domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383781319|ref|YP_005465886.1|
Sequence length 352
Comment putative succinyl-diaminopimelate desuccinylase [Actinoplanes missouriensis 431]
Sequence
MTSLDLTGDIVDLTRTICDIPSVSGDEKALADAVEAALRAYPHLEVLRDADAVVARTSAG
RDTRVVLAGHLDTVPIAGNLPTTMQNQMVYGRGTVDMKAGVAVFLQLAALLDNPRHDVTY
VFYDHEEVAASLNGLGRLVRNHPDWLAGDFAVLGEPSDGTVEGGCQGTMRVKITVPGVAA
HAARSWRGSNAIHSAGAVLDVLRAYEPRRPVVDGLQYREGLNAVRIEGGIAGNVIPDLCT
VFVNHRFAPDRDTDAAEAHLREVFAGFDLEVTDRAPGARPGLDQPAAKEFVDLVGREPQA
KLGWTDVSRFAALGIPAINFGPGDPLLAHTDNEHVPADEIRKALQTLTSWLS
Download sequence
Identical sequences I0HED3
gi|383781319|ref|YP_005465886.1| WP_014446257.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]