SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386845747|ref|YP_006263760.1| from Actinoplanes sp. SE50/110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386845747|ref|YP_006263760.1|
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.77e-21
Family Ribosomal protein S14 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386845747|ref|YP_006263760.1|
Sequence length 61
Comment 30S ribosomal protein S14 [Actinoplanes sp. SE50/110]
Sequence
MAKKALIIKAAAKPKFAVRAYTRCQKCGRPHSVYRKFGLCRVCVRDMAHRGELPGVSKAS
W
Download sequence
Identical sequences A0A0A6UCJ4 A0A101JNQ8 A0A1H2CLV9 A0A1K0F9W7 A0A238XA01 A0A285IVB6 G8SH41 I0GYJ9
2033615975 WP_014440734.1.1565 WP_014440734.1.27 WP_014440734.1.34629 WP_014440734.1.39946 WP_014440734.1.46567 WP_014440734.1.84645 WP_014440734.1.85955 WP_014440734.1.90519 WP_014440734.1.99715 gi|383775786|ref|YP_005460352.1| gi|386845747|ref|YP_006263760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]