SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFQ33137 from Glomerella graminicola 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ33137
Domain Number 1 Region: 661-854
Classification Level Classification E-value
Superfamily Sec7 domain 1.57e-65
Family Sec7 domain 0.000013
Further Details:      
 
Domain Number 2 Region: 399-506,564-646,763-839,1078-1263,1309-1333,1392-1502
Classification Level Classification E-value
Superfamily ARM repeat 0.000000535
Family Plakophilin 1 helical region 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EFQ33137
Sequence length 1586
Comment pep:novel supercontig:GCA_000149035.1:GG697368:26329:31514:-1 gene:GLRG_08281 transcript:EFQ33137 description:"Sec7 domain-containing protein"
Sequence
MSRDDDDLLHTETASAVGARSSVDLRRVGSTPAIAPRMQYRSRPVSVAVDPVSLVMSECI
SITSAIQKHARSPHSSVSAILGGNPNPINLGSPSPSPRGAALKTSGAGLGIDGAQDITSA
NRWGLRGKKGRSIQDNPLMAGFGKLRHELASVRDIHSFDALSLLNPFLQIIQTKGTAAPI
TILTLGALRKFLAYGFISPTSPRFALAMQSLSAAVTRCQFDGSDAGQVEVVLLMILHLME
DMMSGPGGDILSDESVCDMMGRGLAICSQPRFSPVLRRTAEASMVRMCQIIFEDVKHLEV
EAGVESDALDKQTSADMDSVKMDPATSNAPGLQVTSSEQDVRLSTSSSTALDPDPRSQIS
SESGDSKADIGTGIETEGEVDADGAESSDSLDLRPYSLPSVRELFRVLVNFLDPNDRQHT
DTMRVMALRIIHVALEVSGPSIARHPALAGIAEDRLCCYLFQLVRSDNMAILQESLIVAG
TLLATCRGVLKLQQELFLSYLVACLHPSVEIPREPGIDPSLYAGIPQSPKLVKPPPSQTN
SGRSTPVPVKDRQKLGLEGGARKPDARQAMVESIGVLSRMPTFMVELFINYDCDADRADL
CEDMIGLLSRNALPDSATWSTTSVPPLCLDALLRYVQFIAERLGEPHVIDGYPDATALRE
QRRKKKIIIKGTSKFNENPKGGLAYLEAQGIIADVKDPAAVARFLKGTSRVSKKVLGEYL
SKKGSEDVLEAYMSQFDFSEKRVDEALRGLLETFRLPGESALIERIVTCFADKYCSKAKP
TEVANADAVFVLTYAIIMLNTDQHNPNLKGQKRMTVEDFARNLRGVNDGKDFAPEYLQEI
FDNIRTNEIILPDEHDNKHAFDYAWRELLVKSESVQPLVLCETNIYDADMFASTWRPIVS
TLSYVFMSATDDAVFARIVTGFDECARIAASYQNTEALDQIIYSLSHMTTLATEMPSNTS
LNTEVQAGESSVMVSELAVKLGRDFRAQLATLVLFRVVTGSEKLIRNGWKHITRIWLNLF
VNSLVPPFFSADSPVLDIATIPLQTPSQVIDRAAKTAETGFFSAFTSYISSYAADDPPEP
SDEELESTLCTVDCVNSCHMGNVFANISKLSPQELEPLVSALLDALPEDHSTTVIVVKSE
NAPAAPMNGQKPAQTSVVYDPAMAYILEFSTVLALRDQDTVQLVGKRVIEALQAVLRDAG
NYHYIIVSRATFYLLKLLQVSYAHDYINVPVLLHTISSFAKEILTKTSALVLQGLRQCID
EPSPLRNEIMTSPDFWAIMRALAGRQESAPRVFDILELGCGGAPPAIIADNYEAAISLLG
DFASAAGRAVLAERKLESQQRRAHEGTREKTNVNEAIARGSKAVSSIYNMTMRIPFLMKQ
SHLESDEAWSAYWLPVFQALTTQCTNPCRDVRLQAFTSLQRSLLSPDLTCSDHKEWTAIF
GEVLFPLIHKLLKPEVFSSDRDGMSEMRVQAASLLCKVFLQYLVLLSKWDGMLDLWVKII
DIMDRLMNSGQGDSLEEAVRENLKNVVLFMASSGFLVSPTKDASKENLWNETWKRIDRFL
PDLKSDLALEEPRSGEEQAPTAEADA
Download sequence
Identical sequences E3QQJ9
EFQ33137 XP_008097157.1.39555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]