SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFQ33810 from Glomerella graminicola 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFQ33810
Domain Number 1 Region: 633-826
Classification Level Classification E-value
Superfamily Sec7 domain 1.11e-73
Family Sec7 domain 0.0000037
Further Details:      
 
Domain Number 2 Region: 1120-1314,1350-1519,1735-1824
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000196
Family Mo25 protein 0.076
Further Details:      
 
Weak hits

Sequence:  EFQ33810
Domain Number - Region: 32-183
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family Clathrin adaptor core protein 0.075
Further Details:      
 
Domain Number - Region: 12-121,302-434
Classification Level Classification E-value
Superfamily ARM repeat 0.0446
Family Diap1 N-terninal region-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFQ33810
Sequence length 1866
Comment pep:novel supercontig:GCA_000149035.1:GG697373:366350:372002:1 gene:GLRG_08954 transcript:EFQ33810 description:"Sec7 domain-containing protein"
Sequence
MSSLKFLVSSLEAIAASKEAQRNKQLTESLQKTLTAIKESHPDFPDPEIVFAPLQLATRT
GNVQLITSALDCIGKLISYSYFSLPSNPDPQIQDAPPPPDRAPLIERAIDTICDCFQGET
TAVEVQLQIVKSLLAAVLNDKIVVHGAGLLKAVRQVYNVFLLSRNTGNQQMAQGTLTQMV
GTVFERVKTRLHMKEARMSFDKLKISSSNVTFEQTDSVNGAADAEEKEPEQDAEQKEGSP
APAASESAPTEGDENANGKLTLKDLEHRKSFDDSHLGDGPTMVTEIKPGRKPARSVSEQS
TPESSHDDSPEALDAEDEVYIKDAYLVFRSFCNLSTKVLPPDQLYDLRGQPMRSKLISLH
LIHTLLNNNIAVFTSPLCTITNSKSNEPTTFLQAIKFYLCLSITRNGASSVDRVFNVCCE
IFWLMLKYMRESFKLEIAVFLNEIYLALLARRTAPISQKVYVVNILNRFCADSKALVETY
LNYDCERSVDNIFQTIIEDLSKFSTAPVVVTPVQEQQYEEKGARTVSGGDWQLRTILPPP
LSVAQITPQPEPESDIPKEYVMKRIALDALVDSLRSMVDWSAAVRPDANGVRLDGDTRNS
EDIRPSIDPSMSENPSRFETPAPSTPVLEDDPASLEKAKARKTAMNNAIKQFNFKPKRGI
KLLLQEGFIPSESPQDIARFLLTEDRLDKAQIGEYLGEGDPKNIEIMHAFVDAMDFTKKR
FVDALRTFLQSFRLPGEAQKIDRYMLKFAERYVMGNPNAFANADTAYVLAYSVIMLNTDL
HSSKIAKRMSKEEFIKNNRGINDNADLPDEYLLAIYDEIASNEIVLKSEREAAAAAGVAP
PTSTGIAAGLGQALSNMGRDLQREAYLQQSEEIALRSEQLFKTLYKNQRKNAQRSGVRFV
PATSFQHIGPMFDVTWMSYFSALSSQMQKTQNLDINKLCLEGMKLATKIACVFDLSTARE
AFVSALKNTTNLNNPQEMLAKNVEALKVILELGQTEGNVLRSSWKDVLMCISQLDRLQLI
TGGVDESVVPDVSKARFMPPQRENTNDSKSSTQSKRKSNRPRSGTAPQGFSNEIALESRS
DEVIKAVDRIFTNSGNLNGEAIVHFARALTEVSWDEIKVSGSNDSPRTYSLQKIVEIAYY
NMTRVRFEWSNIWEVFGDHFNRVGCHNNITIVFFALDSLRQLSMRFMEFEELAGFKFQKD
FLKPFEHVLANSQNIAVKDMVLRCLIQMIQARGDNIRSGWRTMFGVFTVAAREANESIVN
LAFENVTQVYKTKFGVVISQGAFTDLIVCLTEFSKNMKFQKKSLQALESLKSIIPRMLKT
PECPLSQKNHSASGEHAASAADTLQRSQNRTTVEEGYWFPVLFAFHDVLMTGEDLEVRSN
ALEYFFEALLRYGGEFPPDFWDILWRQQLYPIFMVLRSRPDLNNALNHEELSVWLSTTMI
QALRNMITLFTHYFDALEYMLDRFLELLALCICQENDTISRIGSNCLQQLILKNVTKFTP
DHWSKVVGAFCELFARTTAHQLFSATTINSTASIDMPPNGLDFAAPLSPTETPTEEESLQ
VNGLGKNGGNTDTSSTDAHVSAINDDDLKTPTAPVAPRLQAQSQAPLEEFKPTSNLQQQP
VVVTAARRRYFNRIISRCVLQLLMIETVNELFSNDTVYNQIPTTELLRLMALLKRSYLFA
RKFNADKELRMRLWREGFMKQAPNLLKQESGAAATYVAILFRMYADDSHERTAARDAIEQ
ALVPLCKSIIKDFVALEEDSQHRNIVAWRPVVVDVLEGYAAFPVEAFQKHIKEFYVMAVE
LLGKDVTSELRVALLLVLRRVGEVGLGIEGMTTKVRADRRDSILSSVTDNTAVDGPEGDA
SSRMRR
Download sequence
Identical sequences E3QSI3
EFQ33810 XP_008097830.1.39555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]