SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000027 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000027
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-41
Family Necap1 N-terminal domain-like 0.00000754
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000027   Gene: ENSMLUG00000000028   Transcript: ENSMLUT00000000028
Sequence length 236
Comment pep:novel scaffold:Myoluc2.0:GL430861:390:10744:1 gene:ENSMLUG00000000028 transcript:ENSMLUT00000000028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAEWQLDQPSWSGRLRITAKGQVAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRY
FVIRIEDENGRRAFIGLGFGDRGDAFDFNVALQDHFKWVKQQFEFAKQAQNPDQGPKLDL
GFKEGQTIKLNIANMKKKEGATGTPRARPASTGGLSLLPPPPGAKPSTLIPPPGEQLSVE
GSLAQPAVAPGSGGATVSWPQPTPATTATSDIWGDFAKSTGATSSQTQPGTDWVQF
Download sequence
Identical sequences G1NSC8
ENSMLUP00000000027 ENSMLUP00000000027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]