SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000069 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000069
Domain Number 1 Region: 107-259,313-461
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.26e-112
Family Mammalian PLC 0.000000119
Further Details:      
 
Domain Number 2 Region: 466-591
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.35e-29
Family PLC-like (P variant) 0.00015
Further Details:      
 
Domain Number 3 Region: 2-101
Classification Level Classification E-value
Superfamily EF-hand 1.89e-27
Family EF-hand modules in multidomain proteins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000069   Gene: ENSMLUG00000000073   Transcript: ENSMLUT00000000073
Sequence length 593
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430419:64553:71538:-1 gene:ENSMLUG00000000073 transcript:ENSMLUT00000000073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DNERLEGTEIEEFLRRLLKRPELEEIFHRYSGEDRVLSAPELLEFLEDQGEDGATLAHAQ
QLIQTYELNETAKQHELMTLDGFMMYLLSPEGDALNPAHTCMFQDMDQPLAHYFISSSHN
TYLTDSQIQGLSSTEAYVRAFAQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVVQA
VRDHAFTLSPYPVILSLENHCGLEQQAVMACHLRTILGDMLVTQALDSQNPEELPSPEVM
PPEPQRSSKKGGLIFDHPGCTGGERGLTSSSQNTTCGRACTVRLKLRGPCAEVGFRKGDR
RNKYTRRVWMGELEGVDLSECTSIRAKQISPELSALAVYCCATRLRTLRPAPVPPQPYQV
SSLSERKAKKLIREAGNSFVRHNTRQLTRVYPSGLRMNSANYSPQEMWNSGCQLVALNFQ
TPGYEMDLNAGRFLVNGQCGYVLKPACLRQPDTNFDPESPGPPRTTLTIQVLTAQQLPKL
NAEKPSSIVDPLVRVEIYGVPMDCARKETDYVLNNGFNPHWGQTLQFQLRAPELVLVRFV
VEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATIFVHIRVQH
Download sequence
Identical sequences L7N0X5
ENSMLUP00000000069 ENSMLUP00000000069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]