SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000097 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000097
Domain Number 1 Region: 28-354
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.71e-54
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.05
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000202
Family PHD domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000097   Gene: ENSMLUG00000000101   Transcript: ENSMLUT00000000102
Sequence length 1081
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430344:343256:383845:1 gene:ENSMLUG00000000101 transcript:ENSMLUT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLHFSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHSLGQTPDVKPVQNGSQL
FIKELRSRTFPSAEDVVARVPGSQLTLGYMEEHGFTEPILVPKKDGLGLAVPAPTFYVSD
VENYVGPERSVDVTDVTKQKDCKMKLKEFVDYYYSTSRRRVLSLTSLEFSDTRMSSFVEP
PDIVKKLSWVENYWPDDALLAKPKVTKYCLICVKDSYTDFHIDSGGASAWYHVLKGEKIF
YLIKPASANISLYERWQSASNHSEMFFADQVDKCYKCTLKQGQTLFIPSGWIYATLTPVD
CLAFAGHFLHSLSVEMQMRAYEVERRLKLGSLTQFPNFETACWYMGKHLLEAFKGSHKSG
KQLPPHLVQGAKILNGAFRSWTKKQALAEHEDELPEHFKPSQLIKDLAKEIRLSENASKA
ARPEVTSAISSNEVCFGDREKEEPPSPIEASPPRSFLEKVSKKKTSKTMKIPKPSKVPKP
PKPPKPPKPPKSLKLKDGGKKKGKKCRGSASPTIPNLDLLEAHTKEALTKIEPPKKGKAT
KSVLSVPNKEAISTQNDVERLEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKPPTS
GNKDTKFLFSFSNKKLLGSKALKPQPSPGVFGALQNFKEDKPQPVRDEYEYVSDDGELKI
DEFPIRRKKNAPKRDLSFLLDRKEPLPTPVTKPKLDSALYKPSDDSSSDEGSLRIDTDTK
PTRNAKVKKDGGGSAAGILDLLQASEEVGALDYNPNRKKKKITAKTQDNESPSTQKAIQG
KLSMANQASDSCLQTAWGAGQAKGSSLAAHGARKNGAGGKSAGKRLLKRAAKHSVDLDDY
EEQDHLDACFKDSDYVYPSLESDEDSPVFKSRSKKRKASDDAPYSPTARVGPSVPRQDRP
VREGTRVASIETGLAAAAAKLSQQEEQKSRKKKNSKRKLTPNTTSTSTSASTTSASTTSA
STTSASTTPASATPASTSTASTSTASSQASQEGSSPEIPPEAHSSSLADHEYTVAGTFSG
AQASRASQPMAPGVFLTQRRPSASSPNNTAAKGKRTKKGMATAKQRLGKILKIHRNGKLL
L
Download sequence
Identical sequences G1NSI8
ENSMLUP00000000097 ENSMLUP00000000097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]