SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000109 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000109
Domain Number 1 Region: 10-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.92e-77
Family FCH domain 0.0000000154
Further Details:      
 
Domain Number 2 Region: 527-600
Classification Level Classification E-value
Superfamily SH3-domain 1.04e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000109   Gene: ENSMLUG00000000113   Transcript: ENSMLUT00000000118
Sequence length 610
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429877:3921895:3974321:1 gene:ENSMLUG00000000113 transcript:ENSMLUT00000000118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QHCRLELWDQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFYKFTSCVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQ
EGRKAQQYLDMCWKQMDNSKRKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNL
RTHMADENKNEYAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSE
RKVIPIISKCLEGMVLAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDG
TISASKQESGKVDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSI
EPVHYCMNEIKTGKPRIPSFRSLKRGVSLKLGTALEDFSHLPPEQRRKKLQQRIDELNRE
LQKESDQKYFSIKFSLPLLFLSESILSDVFRCDQNMLETMNNIDRLRPEIHKNEAWLSEV
EGKTGGRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHGHHNEFDDDFEDDD
PLPAIGHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYID
VTLEKNSKGA
Download sequence
Identical sequences G1NSJ7
ENSMLUP00000000109 ENSMLUP00000000109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]