SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000118 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000118
Domain Number 1 Region: 706-1060
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-92
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000072
Further Details:      
 
Domain Number 2 Region: 532-701
Classification Level Classification E-value
Superfamily ARM repeat 3.84e-59
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000333
Further Details:      
 
Domain Number 3 Region: 118-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-50
Family Ras-binding domain, RBD 0.0052
Further Details:      
 
Domain Number 4 Region: 328-497
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.25e-47
Family PLC-like (P variant) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000118   Gene: ENSMLUG00000000124   Transcript: ENSMLUT00000000127
Sequence length 1070
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429775:9194254:9264105:-1 gene:ENSMLUG00000000124 transcript:ENSMLUT00000000127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFNFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISNIKQQML
WAQIHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPG
EKLDSKIGVLIGKGLHEFDALKDPEVNEFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPE
HESSILENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHWKED
EVSPYDYVLQISGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIA
IEAAINRNSSNLPLPLPPKKRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHVWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKTI
NASKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIRFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAISIQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKNGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
Download sequence
Identical sequences G1NSK5
ENSMLUP00000000118 ENSMLUP00000000118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]