SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000119 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000119
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-38
Family VPS36 N-terminal domain-like 0.000000465
Further Details:      
 
Domain Number 2 Region: 277-385
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-28
Family MarR-like transcriptional regulators 0.073
Further Details:      
 
Domain Number 3 Region: 189-311
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000299
Family Vacuolar sorting protein domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000119   Gene: ENSMLUG00000000128   Transcript: ENSMLUT00000000129
Sequence length 386
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429774:11122689:11158309:1 gene:ENSMLUG00000000128 transcript:ENSMLUT00000000129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRFVWTSGLLEIHEALVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQRNHECCMA
IPLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKELGPLQSSKNSYIKLSFKEHGQIEFYR
RLSEEMTQRRWENMPVSQSFQTNRGPQPGRIRAVGIVGIERKLEEKRKETDKNISEAFED
LSKLMVKAKEMVELSKSIANKIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQ
YHMQLAKQLAGILQAPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP
LRLRVFDSGVMVIELLSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKERLLLA
EKMGHLCRDDSVEGLRFYPNLFMTQS
Download sequence
Identical sequences G1NSK6
ENSMLUP00000000119 XP_006083633.1.53796 ENSMLUP00000000119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]