SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000163 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000163
Domain Number 1 Region: 5-364
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.83e-133
Family Motor proteins 0.0000000000193
Further Details:      
 
Domain Number 2 Region: 531-636
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.15e-27
Family FHA domain 0.00000849
Further Details:      
 
Domain Number 3 Region: 1607-1664,1705-1802
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-24
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000163   Gene: ENSMLUG00000000169   Transcript: ENSMLUT00000000179
Sequence length 1823
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430388:66120:178533:1 gene:ENSMLUG00000000169 transcript:ENSMLUT00000000179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGASVKVAVRVRPFNSRETSKESKCIIQMQGNSTSIVNPKNPKEAPKSFSFDYSYWSHT
SPEDPCFASQNRVYNDIGKEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGKQEESQAGIIP
QLCEELFEKINDNCNEEMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVED
LSKLAVTSYTDIADLMDAGNKARTVAATNMNETSSRSHAVFTIVFTQKKHDTETNLSTEK
VSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEVDNCTSKSKKKKK
TDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIKCNAVI
NEDPNAKLVRELKEEVTRLKDLLRAQGLGDIIDIDPLIDDYSGSGGKYLKDFQNNKHRYL
LASENQRPGNFSTASMGSLTSSSSSCSLNSQVGLTSVTSIQERIMSTPGGEEAIERLKES
EKIIAELNETWEEKLRKTEAIRMERSGVRDEMGVAIREDGGTLGVFSPKKTPHLVNLNED
PLMSECLLYYIKDGITRVGQADAERRQDIVLSGAHIKEEHCIFRSERNNSGDVIVTLEPC
ERSETYVNGKRVAHPVQLRSGNRIIMGKNHVFRFNHPEQARAEREKTPSAETPSEPVDWT
FAQRELLEKQGIDMKQEMEKRLQEMEILYKKEKEEADLLLEQQRLDYESKLQALQKQVET
RSLAAETTEEEEEEEEVPWTQHEFELAQWAFRKWKSHQFTSLRDLLWGNAVYLKEANAIS
VELKKKVQFQFVLLTDTLYSPLPPELLPTDMEKTHEDRPFPRTVVAVEVQDLKNGATHYW
SLEKLKQRLDLMREMYDRAGEMASSGQDESETTMTGSDPFYDRFHWFKLVGSSPIFHGCV
NERLADRTPSPTFSTADSDITELADEQQDEMEDFDDEAFVDDTGSDAGTEEGSDLFSDGH
DPFYDRSPWFILVGRAFVYLSNLLYPVPLIHRVAIVSEKGEVRGFLRVAVQAIAAYLADE
EAPDYGSGIRQSGTAKISFDNEYFNQSDFPSVAMTRSGLSLEELRIVEGQGQSSEVISPP
EEINRMNDLDLKSSTLLDGKMVMEGFSEEIGNHLKLGSAFTFRVTVLQASGILPEYADIF
CQFNFLHRHDEAFSTEPLKNNGRGSPLGFYHVQNIAVEVTESFVEYIKTKPIVFEVFGHY
QQHPLHLQGQDLNSPPQPSRRFFPPPMPLSKPVPATKLNTMSKTSLGQSMSKYDLLVWFE
ISELEPTGEYIPAVVDHTAGLPCQGTFLLHQGIQRRITMTIVHEKGSELHWKDVRELVVG
RIRNKAEVDEAAVDAILSLNIISAKYLKSSHNSSRTFYRFEAVWDSSLHNSLLLNRVTPY
GEKIYMTLSAYLELDHCIQPAVITKDVCMVFYSRDAKISPAATRSHQTHSLYEKILNSNR
VTGIYELSLCKMADTGSPGMQRRRRKVLDTSVAYVRGEENLAGWRPRGDSLILEHQWELE
KLELIHEVEKTRHFLLLRERLGDSAPKSLSDSLSPSLSSGTLSTSTSISSQISTTTFESA
ITPSESSGYDSADIESLVDREKELATKCLQLLTHTFNREFSQVHGSISDCKLSDISPIGR
DPSVSSFSSSTLTPSSTCPSLVDSRSNSVDQNKPLVPLIPVLLTCPSTPTLLLSSVIPHI
GSPILGKTNGDNFNSLRPDIEEIRPGSVVSKKGYLHFKEPFSSNWAKHFVVVRRPYVFIY
NSDKDPVERGIINLSTAQVEYSEDQQAMVKSPNIFAVCTKHRGVLLQALNDKDMSDWLYA
FNPLLAGTIRSKLSLRGSSQLKY
Download sequence
Identical sequences G1NSP5
ENSMLUP00000000163 ENSMLUP00000000163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]