SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000176 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000176
Domain Number 1 Region: 227-307
Classification Level Classification E-value
Superfamily C-terminal domain of DFF45/ICAD (DFF-C domain) 8.63e-34
Family C-terminal domain of DFF45/ICAD (DFF-C domain) 0.0000192
Further Details:      
 
Domain Number 2 Region: 8-98
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.26e-29
Family CAD domain 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000176   Gene: ENSMLUG00000000194   Transcript: ENSMLUT00000000192
Sequence length 331
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430388:235645:243949:-1 gene:ENSMLUG00000000194 transcript:ENSMLUT00000000192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSWGASGPEPGDNQALKPCLLRRNHSREQYGVAASCLEDLRSKAYDILAMDKSLAPIT
LVLAEDGTIVDDDDYFLCLPSNTKFVALAGNEKWAYNNSDGGTAWLSQESVDVDETDSGA
ELKWRNVARQLKEDLSSIVLLSEEDLQVLIDVPCADLAQELGQSCVTVQGLQNTLQQVLD
QREEARQSRQLLELYLQALEKEGSILSKQQESQAGLGDGGDAVDTGLSREPSSEIALSSQ
ILTVLKEKPAPELSLSSQDLELVTKEDPKALAVALHWDVKKTETVQQACEQELSLRLQQV
QSLHSLRSISARRDSLPGEQQNPKRARQEPA
Download sequence
Identical sequences G1NSQ7
ENSMLUP00000000176 XP_006104981.1.53796 ENSMLUP00000000176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]