SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000189 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000189
Domain Number 1 Region: 973-1150
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 542-659
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.67e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.00094
Further Details:      
 
Domain Number 3 Region: 684-855
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-26
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 4 Region: 10-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000565
Family SAM (sterile alpha motif) domain 0.006
Further Details:      
 
Domain Number 5 Region: 1284-1439
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000104
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 6 Region: 368-421
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000478
Family Pleckstrin-homology domain (PH domain) 0.0079
Further Details:      
 
Domain Number 7 Region: 870-999
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000373
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 8 Region: 445-572
Classification Level Classification E-value
Superfamily PH domain-like 0.0000498
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000000189
Domain Number - Region: 1185-1258
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00568
Family Ras-binding domain, RBD 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000189   Gene: ENSMLUG00000000196   Transcript: ENSMLUT00000000207
Sequence length 1457
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429905:488612:527125:1 gene:ENSMLUG00000000196 transcript:ENSMLUT00000000207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAGDAALSVAEWLQALHLEQYTVLFEHHGLVRATDCQGLSDARLVDMGVQLPGHRRRI
LAGLLRAHAPPAPAPRPTPRPVPRKRNVFRPLPSPTTPPEPLPTTREDEGLPTAPPIPPR
RSCLPPACFSTPSTAVPDPALPPALPPLPAKRHLAELSVPPVPPRTVHPRPSVSPPYKEE
ELLSSPLSTSPQPEPEESPATFPREPPPPSPSLPDIPPKPLHRFPEFDDPDYDETPEEGP
GAPAGVMTKKEEPPVSQVPRAVRVASLLSEGEELSDDQGDEEEDDQAYEGIPNGGWRTSH
LSSSLPSSLLIPELPPHPMDRLRVKERDVLTTVRNGAIAFISTEVERFGVLSLENPPQYS
SSLFPGRYSKRFISVACISRVAAIEDQKFEVITNNRTFAFRAESDAERKEWIQALQQAVA
EQRARARLSSASLLGVQGSELPDRAGSLELRGIKNKLYVAVVGDKVQLYKNLEEFSVSVS
VTGPAHSPSSLSSALTPRVSTNLTYPLFSHSYVSSFSAETELEKEQWLEAMQGAIAEALS
TSEVAERIWAAAPNRFCADCGAAQPDWASINLCVVICKRCAGEHRGMGAGVSKVRSLKMD
RKVWTETLIELFLQLGNGAGNRFWAASVPPSEALQPHSSPSARRRHLEAKYLEGKYRRYH
PLFGNQEELDKALCAAVTTTDLAETQALLGCGAGVNCFSGDPEAPTPLALAEQAGQTLQM
EFLRNNRTTEVPRLDLMKPLEKHYSVVLPTVSHSGFLYKTASAAKLLQDRRAREEFSRRW
CVLSDGVLSYYENERAVTPNGEIRASEIVCLAVSPPDTHGFEHTFEVYTEGERLYLFGLE
SADLAREWVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLTGSELHA
IFPEGPCEEPLQLRKLQELSVQGDSENQVLVLVERRRTLYIQGERRLDFAGWLGSIQKAA
ASSGDTLSEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKSGQTSKTQQLLESLRQDAR
SVRLKEGEQHVDNVSSALKRFLRDLPDGLFTRAQRLFWLEASEIEDEEEKISRYRGLLAR
LPPVNRATVKALISHLYCVQCFSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGHVVEDLIN
HYVVVFSVDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAEAEQHIKI
PASMTAEELTLEILDRRNVSIREKDYWTCFEVNEREETERPLHFSEKVLPILHGLGIDSY
LVVKKYQSMEAMLLYLASHVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRL
YKEIRSQRPWSGAPETSHRPEKEWPVKSLQVYLGVKKKLRPPTCWGFTVVHETEKHEKQQ
WYLCCETQMELREWFATFLFVQHDGLVWPSEPSRVSRVVPEVRIGSVSLIPLRGNENEMR
RSVAAFAADPLSLLRNM
Download sequence
Identical sequences G1NSR9
ENSMLUP00000000189 ENSMLUP00000000189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]