SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000196 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000196
Domain Number 1 Region: 4011-4367
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.35e-130
Family Hect, E3 ligase catalytic domain 0.0000000327
Further Details:      
 
Domain Number 2 Region: 1617-1680
Classification Level Classification E-value
Superfamily WWE domain 3.79e-17
Family WWE domain 0.0024
Further Details:      
 
Domain Number 3 Region: 1303-1358
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000964
Family UBA domain 0.0061
Further Details:      
 
Domain Number 4 Region: 85-165,274-423,507-638
Classification Level Classification E-value
Superfamily ARM repeat 0.0000159
Family Plakophilin 1 helical region 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000196   Gene: ENSMLUG00000000179   Transcript: ENSMLUT00000000214
Sequence length 4374
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429936:479772:590338:-1 gene:ENSMLUG00000000179 transcript:ENSMLUT00000000214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEKEQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPSTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSL
KHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREV
LGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLG
SAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGNATAPPPRSNH
AAEEASSEDEEEEEVQAMQSFNSAQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESI
LSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKV
LQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAH
AYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSL
PSGCEFGQADMQKLVPKDEKAGTTQGGKRADGEQDATAASMDASTQGLLEGIGLDGDTLA
PMETDEPTTSDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVAEGLEHSDLPDGTGEFLD
AWLMLVEKMVNPTTVLESPHSLPAKLPGSVQNFPQFSALRFLVVTQKAAFTCIKNLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRRDPQVNQQ
QLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIA
MSLGQDIPMDQRAESPEEVACRKEEEERKAREKQEEEEAKCLEKFQDADPLEQDELHTFT
DTMLPGCFHLLDELPDTVYRVCDLIMTAIKRNGADYRDMILKQVVNQVWEAADVLIKAAL
PLTTSDTKTVSEWISQMATLPQASNLATRILLLTLLFEELKLPCAWVVESSGILNVLIKL
LEVVQPCLQAAKEQKEVQTPKWITPVLLLIDFYEKTAISSKRRAQMTKYLQSNNNNWRWF
DDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVML
TLLRVPRLNKNSKNGNGQELEKTLEESKEIDIKRKDSKTNVVDTPLALENTNNEKETSLE
ETKIGEILIQGLTEDMVTVLIRACVSMLGVPVDPDTLHATLRLCLRLTRDHKYAMMFAEL
KSTRMILNLTQSSGFNGFTPLVTLLLRHIIEDPCTLRHTMEKVVRSAATSGAGSTTSGVV
SGSLGSREINYILRVLGPAACRNPDIFTEVANCCIRIALPAPRGSGTASDDEFENLRIKG
PNAVQLVKTTPLKPSPLPVIPDTIKEVIYDMLNALAAYHAPEEADKSDPKPGGMTQEVGQ
LLQDMGDDVYQQYRSLTRQGSDFDTQSSFSINSQVFATDGSSTETNTPGASQEAASTPEE
SRDGKKDKEGDRASEEAKQKVKGSKPLMPTSTILRLLAELVRSYVGIATLIANYSYTVGQ
SELIKEDCSVLAFVLDHLLPHTQNAEDKDTPALARLFLASLAAAGSGTDAQVALVNEVKA
ALGRALAMAESTEKHARLQAVMCIISTIMESCPSTSSFYSSATAKTQHNGMNNIIRLFLK
KGLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGSKSASNKTKAEQD
AQGATQDSNSNQQDPGEPGEAEVQEEDHDVTQTEVADGDIMDGEAETDSVVIAGQPEVLS
SQEMQVENELEDLIDELLERDGGSGNSTIIVSRSGEDESQEDVLMDEAPSNLSQASTLQA
NREDSMNILDPEDEEEHTQEEDSSGSNEDEDDSQDEEEEEEEDEEDDQEDDEGEEGDEDD
DDDGSEMELDEDYPDMNASPLVRFERFDREDDLIIEFDNMFSSATDIPPSPGNIPTTHPL
MVRHADHSSLTLGSGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQ
RLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQA
GTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVPIVNHLEFLRDEELEERREKRRKQLA
EEETKITDKGKEDKENRDQNAQCVASKTNDSTEQNLTEKDGTPMPDSYPTTPSSTDAATS
ESKEANVTLQPSQQQPTLPAPPALGEIAQELQSPTGEGGNSAQLLMPVEPVELGTTRPSG
EGETTQMELSPAPTITSLSPERAEDSDALTAVSSQLEGSPMDTSSLASCTLEEAVGDTSA
AGSSEQPTAGSSTSGDAPPVVAEVQGRGDRSGEPAQSGENSSTPASSESSSIRESAVVIS
GGDSQGILEEPLPSTSSEEEDPLAGISLPEGVDPSFLAALPDDIRREVLQNQLGIRPPTR
PAPSTNSSTPAVVANPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELAQNASSDTPM
DPVTFIQTLPSDLRRSVLEDMEDSVLAVMPPDIAAEAQALRREQEARQRQLMHERLFGHS
STSALSAILRSPAFTSRLSGNRGVQYTRLAVQRGGTFQMGGSSSHNRPSGSNVDTLLRLR
GRLLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHAQTRHWVIRSLLSILQRSSES
ELCIETPKLSSEEKGKKSSKSCGSGSHENRPLDLLHKMESKSSNQLSWLSVSMDAALGCR
TNIFQIQRSGGRKHTEKHASSGSTVHIHPQAAPVVCRHVLDTLIQLAKVFPSHFTQQRTK
ETNCESDRERGGKQACSPCSSQSSGSGICTDFWDLLVKLDNMNVSRKGKNSVKSVPVSTG
NEGETSPYSLEASPLGQLMNMLSHPVIRRSSLLTEKLLRLLSLISIALPENKVSETQANS
GSGASSTAAATSTTSTTTTTVASNTPTPPAATTPVTSAPALVTATAISTITIAASTTVTT
PTTATTTVSATTKSSKSPAKGGDMGTGTADFKMVSSGLTENQLQLSVEVLTSHSCSEEGL
EDAANVLLQLSRGDPGTRDTVLKLLLNGARHLGYTLCKQIGTLLAELREYNLEQQRRAQC
ETLSPDGLPEEQPQTTKLKGKMQSRFDMAENVVIVASQKRPLGGRELQLPSMSMLTSKTS
TQKFFLRVLQVIIQLRDDTRRANKKAKQTGRLGSSGLGSASSIQAAVRQLEAEADAIIQM
VREGQRARRQQQAATSDSSQSEGSVRREESPMDVDQPSPSTQDTQSTGSDGNSQGEKEER
PPDLPLLSEQLSLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKPPV
RDTRESQLAHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSSLPPDTQKFLRFAE
THRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVH
VRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYAL
FRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKS
VRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTE
ENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDID
DLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGI
QKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA
Download sequence
Identical sequences G1NSS6
ENSMLUP00000000196 ENSMLUP00000000196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]