SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000215 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000215
Domain Number 1 Region: 3-139
Classification Level Classification E-value
Superfamily PX domain 9.03e-18
Family PX domain 0.00000643
Further Details:      
 
Domain Number 2 Region: 153-192
Classification Level Classification E-value
Superfamily SH3-domain 0.0000072
Family SH3-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000215   Gene: ENSMLUG00000000233   Transcript: ENSMLUT00000000233
Sequence length 194
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:4835063:4848667:-1 gene:ENSMLUG00000000233 transcript:ENSMLUT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDTFIRHIALLGFEKRYVPSQHYVYMFLVKWQDLSEKLVYRRFTEIYEFHVSTLLGSGG
QGGTAHPRPRCCLGAEAPGVCPHQPTPRSARATLTEVLQCTHGPAVKISRCPLLLDFFKV
RPDDLKLPTDSQVKKPETYLVPKDGKTNAAAADITGPIILQTYRAIADYEKSSGTEMALA
MGDVVDVVEKGESG
Download sequence
Identical sequences G1NSU5
ENSMLUP00000000215 ENSMLUP00000000215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]