SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000216 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000216
Domain Number 1 Region: 626-682
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000105
Family Tudor domain 0.0000558
Further Details:      
 
Domain Number 2 Region: 261-315
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000074
Family UBA domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000216   Gene: ENSMLUG00000000235   Transcript: ENSMLUT00000000234
Sequence length 685
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429841:729033:803373:-1 gene:ENSMLUG00000000235 transcript:ENSMLUT00000000234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPATGAWLVRTSRYLSDEGIEACTSSPDKVNLNDIILIALNLEGPCVLQIQKIRNVAAP
KDNEESQAAPRMLRLQMTDGHISCTAVEYSYMSKISLNTPPGTKVKLSGIVDVKNGFLLL
NDSNTTILGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSNVQMDSREL
DRRKTLQVTMPVKPPSDNDEFEKQRTAAIAEVAKSKETKTFGGGGGSARSNLNMSAAGNR
NREILQKEKPTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNV
LLNSNKQKPVSGPPLRGKGKGRGRIRSEDEEELGNARPSAPSTLFDFLESKMGTLSVEEP
KSQPQQLHQGQHRLLNTEQNGIKDSNQTRYLPRNDTRQPRNEKPPRFQRDTQNSKSILEG
SGLPRYRGTERPSTSSGSEGWAEERIRCDRPYSRYDRTKDTSYPLGSQHNDGAFRKRDNS
MQNRSGRGPAYAEAKENPLPQESIDYNNQKRGKRENQTANPDHFYDRKPRTINNEAFSGV
KIEKHFPINTDYQNPVRTNSFIGVPNGETEMPLKGRRVGPIKPTGPTTATPYDDKVFYNS
GPKRRSGPIKPEKVLEPSVPMEYAKLWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVV
KFIDYGNYEEVLLSNIRPIQTEAWW
Download sequence
Identical sequences G1NSU6
ENSMLUP00000000216 ENSMLUP00000000216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]