SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000293 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000293
Domain Number 1 Region: 137-225
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 2 Region: 20-58
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000173
Family PDZ domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000293   Gene: ENSMLUG00000000320   Transcript: ENSMLUT00000000322
Sequence length 773
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429797:2838139:2901341:-1 gene:ENSMLUG00000000320 transcript:ENSMLUT00000000322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YHSSLSVLSSEMSNVLLSSQVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSKPIY
GAAPEVQLMNASTQTDITFEHIMALAKLRPPTPPVPDICPFLLSDSCHSLHPMEHEFYED
NEYLSSLPADADRTEDFEYEEVELCRVSSQEKLGLTVCYRTDDEEDTGIYVSEVDPNSIA
AKDGRIREGDRILQINGEDVQNREEAVALLSSDECRRIVLLVARPEIQLDEGWLEDERNE
FLEELNLEMLEEQHNEAMQHTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRTDES
LRNDESSEQENAAEDPKSTSLKSKRELGSQDTLGSVELQCNESFVSGEYIDSDCPGNQDE
ECERFRQLLELKCKIQNHGEYDLYYSSSTIECNQGEQEGVEHELQLLNEELRNIELECQN
IMQAHRLQKVTDQYGDIWALHDGGFRNYNTSVDMQRGKLDDIIEHPEKSDKDSSSAYNTA
ESCRSTPLTVDRSPDSSLPRMINLTNKKNLRSTMAASQSSPGQSSKESTSTKAKTTEGGG
IEGKEKISESNKLSDQEKTGSEHIPYLSPYHSSSYRYANIPAHARHYQSYMQLIQQKSAV
EYAQSQLSLVSMCKESQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILKERALKIKEERS
GMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSGSEGKK
EINIIELSHKKMMKKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV
Download sequence
Identical sequences G1NT15
ENSMLUP00000000293 ENSMLUP00000000293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]