SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000371 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000371
Domain Number 1 Region: 153-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.36e-27
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 5.11e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000371   Gene: ENSMLUG00000000406   Transcript: ENSMLUT00000000407
Sequence length 296
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430498:118103:120674:1 gene:ENSMLUG00000000406 transcript:ENSMLUT00000000407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLPTPLGHVL
GREPTSSEQGGPEGPGSPAEEGKLVLSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRKEKAEELAARQRVREKIERDKAERAKKYG
GSVSSQPSAPAEPGSVPSSPSQEPPSKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVRL
YVELHRGEEPGGDQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
Download sequence
Identical sequences G1NT85
ENSMLUP00000000371 ENSMLUP00000000371 XP_006105943.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]