SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000374 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000374
Domain Number 1 Region: 311-601
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-74
Family Protein kinases, catalytic subunit 0.0000901
Further Details:      
 
Domain Number 2 Region: 33-96
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000042
Family LIM domain 0.0022
Further Details:      
 
Domain Number 3 Region: 91-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000228
Family LIM domain 0.0046
Further Details:      
 
Domain Number 4 Region: 140-241
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000315
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 3-32
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000205
Family LIM domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000374   Gene: ENSMLUG00000000411   Transcript: ENSMLUT00000000410
Sequence length 633
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:5353123:5376900:-1 gene:ENSMLUG00000000411 transcript:ENSMLUT00000000410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSELPVCASCGQRIYDGQYLQALNTDWHADCFRCCECSAPLSHQYYEKDGQLFCKKDYWA
RYGESCHGCSEHITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCY
YQTVVTPVIEQILPDSPGSHLPHTVTLVSIPATAHGKRGLSVSIDPPHGPPGCGTEHSHT
VRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDP
HDTLGHVAGPEPSPLGSPAHTPSGEAGSSARQKPVLRSYSIDRSPGAGSLGSPASQCRDL
GRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQ
RTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRV
SFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEDQPED
LRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLP
RTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLAGH
LPLGSQLEQLDRGFWETYRRGESGLPAHPEVPD
Download sequence
Identical sequences G1NT88
ENSMLUP00000000374 ENSMLUP00000000374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]