SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000439 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000439
Domain Number 1 Region: 468-510,712-818
Classification Level Classification E-value
Superfamily PH domain-like 5.43e-22
Family Pleckstrin-homology domain (PH domain) 0.005
Further Details:      
 
Domain Number 2 Region: 57-360
Classification Level Classification E-value
Superfamily ARM repeat 0.000000101
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000439   Gene: ENSMLUG00000000477   Transcript: ENSMLUT00000000482
Sequence length 832
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429837:2061530:2246083:1 gene:ENSMLUG00000000477 transcript:ENSMLUT00000000482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHLFRLVLGQKDLSRAGDLFSLDDSEIEDSLTEALEQIKIISSSSDYQTNNNDQAVVEI
CITRITTAIRETESIEKHAKALVGLWDSCLEHNLRPSGKDEDTPHAKIASDIMSCILQNY
NRPPVMALAIPIAVKFLHRSNKELCRNMSNYLSLAAITKADLLADHTEVIVKSILQGNTM
LLRVLPAVYEKQPQPINRHLTELLALMSQLEQPEQYHLLRLLHVAAKRKQPEVVQKCIPF
LIRHLKDSSHSDVILNILIEIAGYEPVALNSFLPMLREIGERFPYLIGQMARIYGAVGHV
DEERARSCLPFLVSQLANMEHSFHHILLLEIKSITDTFSSLLGPQSRDIFRMSNSFTAIA
KLLTRQLETTKPQSGRRKISTEIEFPEKLEETKLTAAENEDQKKLHVKIQAFEDKINAEI
NTPGSIRRYSLGQVSKEERKDIRFNRSKSLALHTVLTKGMSSDDGEVVERGDIPASISLS
EIDSLSQGNKSPFKADTDGSQLGNSSVSHPSIIHIESENLPETVKKNYQEETPETTVSPV
EYQDKLYLHLKKNLSKVKAYAVEIGKKIPVPDQCTIEDSVRSCVAKLFFTCSLKGHYCLY
SKSSFILISQEPQPWIQIMFLFQQSLFPEPLSIQSRSVQFLRSLWEKTQAEGAHSFETAM
LESTFPQQKDLDQVQLHLEEVRFFDVFGFSEAAGAWQCFMCNNPEKAAVVNQDGQPLIEG
KLKEKQVRWKFIKRWKTRYFTLAGNQLLFQKGKSKDDPDDSPIELSKVQSVKVVARKRRD
RSLPRAFEIFTDNKTYVFKAKDEKNAEEWLQCINVAVAQAKERESREVTTYL
Download sequence
Identical sequences G1NTE7
ENSMLUP00000000439 ENSMLUP00000000439 XP_006090374.1.53796 XP_006090375.1.53796 XP_014312652.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]