SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000448 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000448
Domain Number 1 Region: 406-611
Classification Level Classification E-value
Superfamily PUA domain-like 3.23e-73
Family SRA domain-like 0.0000000217
Further Details:      
 
Domain Number 2 Region: 707-774
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000126
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 1-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000023
Family Ubiquitin-related 0.0000487
Further Details:      
 
Domain Number 4 Region: 320-375
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000288
Family PHD domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000448   Gene: ENSMLUG00000000489   Transcript: ENSMLUT00000000492
Sequence length 791
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430300:395451:452766:1 gene:ENSMLUG00000000489 transcript:ENSMLUT00000000492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTIDGSQTRTIEDVSRPQFEELRERVWALFDVRPECQRFYRGKQLEDGYTLFDYD
VGLNDIIQLLARPDSDLPSTSKQSDVKAKPCSDNPPKVKKASRVRSSSQPRTSARDFLID
PGIGLYKVNELVDVRDVNYGSWFEARIHSITRASDEHSRGKTPLKNGSSYSVAADEDVIY
HIEFDEYPESGIVKVNLKDLRPRARTILKWNQLNIGDVVMVNYNAEIPSNRGHWFDAEIT
ELKTISRTKKELHATVFLGGSDGKLNDCQIKFVNEIYKIEKPGAHPLSLADESNPLILCH
ILGRNEPECNFCHGDPDKNCHNCSCRECGEKRDPSMQLLCDECNQAYHIYCLNPPLDKVP
EEEWYCPSCKTDSSEVVKAGEKLKMSKKKAKMPSASTGSRRDWGRGMACVGRTKECTIVP
SNHYGPIPGIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGD
EFTYTGSGGKNLAGNKRIGSPSADQTLTNMNRALALNCDAPLDDKVGAESRNWRAGKPVR
VIRSFKGRKISKYAPEEGNRYDGIYKVVKYWPEKSTSHGFLVWRYLLRRDDDEPAPWTSE
GIERSRRLCLRLQYPVGYPSDKEGKKTKGQSKKAGETSKRPAPDDVSQPKQQQIQYPTLQ
VFKADSAEAVEAFQLTPEQQHLIREDHQNQKLWDEVLAYLVEGPAPWRYQNFLKKLEQSF
MCVCCQELVYQPVTTDCLHNVCKDCLQRSFKAQVFSCPACRHDLGQNYIMIPNEILQTLL
DLFFPGYSKGR
Download sequence
Identical sequences G1NTF4
ENSMLUP00000000448 ENSMLUP00000000448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]