SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000453 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000453
Domain Number 1 Region: 28-47,86-180
Classification Level Classification E-value
Superfamily GAT-like domain 2.62e-34
Family GAT domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 1-31
Classification Level Classification E-value
Superfamily ENTH/VHS domain 0.0000268
Family VHS domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000453   Gene: ENSMLUG00000000496   Transcript: ENSMLUT00000000499
Sequence length 234
Comment pep:known_by_projection scaffold:Myoluc2.0:GL432178:4868:18517:1 gene:ENSMLUG00000000496 transcript:ENSMLUT00000000499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAWADAFRSSPDLTGVVHIYEELKRKGVEFPNADLDALSPIHTPQRSVPEVDPAATVPRS
QAQQRTSAGSFSSPPPPPFSRAAGPGSESNAEQIARLRSELDIVRGNTKVMSEMLTEMVP
GQEDSSDLELLQELNRTCRAMQQRVVELISHVCNEEVTEELLRVNDDLNNVFLRYERFER
FRSGRLVQNASNGVLSEVTEDNLIDLGPGSPAVVSPMVGSTAPPPSLSSQLAGL
Download sequence
Identical sequences G1NTF9
ENSMLUP00000000453 ENSMLUP00000000453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]