SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000456 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000456
Domain Number 1 Region: 29-161
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-27
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 756-860
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-20
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000456   Gene: ENSMLUG00000000500   Transcript: ENSMLUT00000000503
Sequence length 1006
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430371:169148:183344:1 gene:ENSMLUG00000000500 transcript:ENSMLUT00000000503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAPMASSVSISDLRWLFPLQLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDL
SSGYWVLVVHFTRREAIKQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENLGLL
HKYYVKNALVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYYKPQHLLDFED
RLPSSAHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDGDLTDTVSGPRSTASDLTSSKA
STKSPTQRHNPFNEEQAEAVSSSDTTPVHTASQGKEPHPPELLDAGTELEVIRVTKKKKA
GKKKKTRSDEEASPLRPASAQHTGARRGDGDSRVSSPGLGRGSPDTTLASPQEKGEGPSS
AAESSERSEPSQMGLLIPEMKDTSMERVGQPLSKVIDQLNGQLDPRTWCSHGEPPDQPFR
TGSPGDTPERPPFCDFSEGLPAPMDFYRFTVESPSTVTSGGGHHDPAGPSQPLHVPGGPA
AAGQEEEGGGGGEGQAPPPLGATLGEAQEPETRAPETQVPPVKEGPGPEPESGTQEALCQ
LKRDQPSPCLSSAEDSGVEEGQGSPSEMSHSAEFRVDNNHLLLLMIHVFRENEEQLFKMI
RMSTGHMEGTLQLLYVLLTDCYVYLLRKGATEKPYLVEEAVSYNELDYVSVGLDQQAVRL
VCTNRRKQFLLDTADAALAEFFLASLKSAMIKGCREPPYPSILTDATMEKLALAKFVAQE
SKCEAAAVTVRFYGLVHWEDPTDESLGPVPCHCSPPEGAITKEGMLHYKAGTSYLGKELW
KTCFVVLSNGILYQYPDRTDVIPLLSVNMGGEQCGGCRRSNTTDRPHAFQVILADRPCLE
LSAESEAEMADWMQHLCQAVSKGVIPQGVPPSPCIPCCLVITDDRLFTCHEDCQTSFFRS
LGTAALADISAVSTEPGREYCVLEFSRDGQQPLPPWVIYLSCTSELDRFLSALNSGWRTI
YQVDLPHKAIQEASHKKFEDALSLIHSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences G1NTG1
ENSMLUP00000000456 ENSMLUP00000000456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]