SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000496 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000496
Domain Number 1 Region: 49-147
Classification Level Classification E-value
Superfamily SH2 domain 1.37e-28
Family SH2 domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 189-206,261-315
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-22
Family SH3-domain 0.0000397
Further Details:      
 
Domain Number 3 Region: 3-54
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000296
Family SH3-domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000496   Gene: ENSMLUG00000000549   Transcript: ENSMLUT00000000547
Sequence length 318
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430006:1692477:1712438:-1 gene:ENSMLUG00000000549 transcript:ENSMLUT00000000547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKFDFTASGEDELSFHTGDTLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPEWFH
EGLSRHQAENLLMAKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDSKGNYFLWTE
KFPSLNKLVDYYRTTSISKQKQIFLRDRTREDQGRRGNSLDRWPQGGPHISGAVGEETRP
AMNRKLSDHPPPPPSQYPPAPPPAQQRYLQHHHFHQERRGGSLDINDGHCGLGMGMGSEM
NATLMHRRHTDPVQLQVAGRVRWAQALYDFEALEDDELGFRSGEVVEVLDSSNPSWWTGR
LHNKLGLFPANYVAPMIR
Download sequence
Identical sequences G1NTJ8
XP_006098615.1.53796 XP_014319648.1.53796 XP_014319649.1.53796 ENSMLUP00000000496 ENSMLUP00000000496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]