SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000542 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000542
Domain Number 1 Region: 213-315,351-405,443-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.94e-42
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 2 Region: 508-695
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-41
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 3 Region: 37-132
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-17
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000542   Gene: ENSMLUG00000000601   Transcript: ENSMLUT00000000598
Sequence length 1004
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429933:420744:665557:1 gene:ENSMLUG00000000601 transcript:ENSMLUT00000000598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGKRGLVAPQNTFLENIVRRSSESSFLLGNAQIVDWPVVYSNDGFCKLSGYHRADVMQ
KSSTCSFMYGELTDKKTIEKVRQTFDNYESNCFEVLLYKKNRTPVWFYMQIAPIRNEHEK
VVLFLCTFKDITLFKQPIEDDSTKGWTKFARLTRALTNSRSVLQQLTPMNKTEVVHKHSR
LAEVLQLGSDILPQYKQEAPKTPPHIILHYCAFKTTWDWVILILTFYTAIMVPYNVSFKT
KQNNIAWLVLDSVVDVIFLVDIVLNFHTTFVGPGGEVISDPKLIRMNYLKTWFVIDLLSC
LPYDIINAFENVDEVSKFIFKNYGEKGIIGFMKEIPKPYQNNSPQGISSLFSSLKVVRLL
RLGRVARKLDHYLEYGAAVLVLLVCVFGLVAHWLACIWYSIGDYEVIDEATNTIQIDSWL
YQLALSIGTPYRFNSSAGIWEGGPSKDSLYVSSLYFTMTSLTTIGFGNIAPTTDVEKMFS
VAMMMVGSLLYATIFGNVTTIFQQMYANTNRYHEMLNNVRDFLKLYQVPKGLSERVMDYI
VSTWSMSKGIDTEKVLSICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTI
HCAPGDLIYHAGESVDALCFVVSGSLEVIQDDEVVAILGKGDVFGDIFWKETTLAHACAN
VRALTYCDLHIIKREALLKVLDFYTAFANSFSRNLTLTCNLRKRIIFRKISDVKKEEEER
LRQKNEVTLSIPVDHPVRKLFQKFKQQKELRNQGSSQSDPERNQLQVESRSLQNGASITG
TSVVTVSQITPIQTSLAFVRTSESLKQNNRDAMELKPNGGADPKCLKVNSPIRMKNGNGK
GWLRLKNHMGAHEEKKEDWNNVTKAESMGLLSEDPKGSDSENSVTKNPLRKTDSCDSGIT
KSDLRLDKAGEVRSPLEHSPIQADAKHPFYPIPEQALQTTLQEVKHELKEDIQLLSCRMT
ALEKQVAEILKILSEKSAPQTSSPESHVSRPESPESDKESFGSQ
Download sequence
Identical sequences G1NTN8
ENSMLUP00000000542 ENSMLUP00000000542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]