SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000547 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000547
Domain Number 1 Region: 82-272
Classification Level Classification E-value
Superfamily PH domain-like 3.41e-40
Family Pleckstrin-homology domain (PH domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000547   Gene: ENSMLUG00000000603   Transcript: ENSMLUT00000000604
Sequence length 552
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429828:4257859:4304923:-1 gene:ENSMLUG00000000603 transcript:ENSMLUT00000000604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNKFILEKVQDNFDKLELNRM
CWTLCVKKNLTKSPLLIEEEDSFKVWVIFNFLSEDKYPLIIVPEEIEYLLKKLTDAMGGV
WQQEQFEDYKVNFDDGKDGLSVWELIELVGTGQFSKGMDRQTVSMAINEVFNELILDVLK
QGYMMKKGHRRKNWTERWFVLKPNVISYYVSEDLKDKKGDIVLDENCCVESLPDKDGKKC
LFLIKCLDKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQSRRERRRKLLAE
QEELERQMKELQAANENKQRELETVRKKLEEAASRAAEEEKKRLETQVELQARFSSELER
EKLIRQQMEEQVAQKSCELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQARL
LEEESSKRAELERWHLEQQQAIETTEAEKQELENQRIMKERALQEAMAQLEQLELERKQA
LEQYEGVKKKLEMATSKTKSWKDKVAQHEGLIRLIEPGSKNPHLVTHWGPAAFTQAELEE
REKSWKGKKGTE
Download sequence
Identical sequences G1NTP3
ENSMLUP00000000547 ENSMLUP00000000547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]