SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000550 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000550
Domain Number 1 Region: 148-399
Classification Level Classification E-value
Superfamily VPS9 domain 1.44e-82
Family VPS9 domain 0.000000000628
Further Details:      
 
Domain Number 2 Region: 30-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000627
Family A20-like zinc finger 0.0000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000550   Gene: ENSMLUG00000000605   Transcript: ENSMLUT00000000608
Sequence length 504
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:915775:945224:1 gene:ENSMLUG00000000605 transcript:ENSMLUT00000000608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HFLVCYLINRKKMSLKSERRGIHVDQSELLCKKGCGYYGNPAWQGFCSKCWREEYHKARQ
KQIQEDWELAERLQREEEEAFASSQTSQGAQSLTFSKFEEKKTNEKTRKVTTVKKFFSAS
SRVGSKKAEIQEAKAPSPSINRQTSIETDRVSKEFIEFLKTFHKTGQEIYKQTKMFLEAM
HYKRNLSTTWDSSCVQNNYKNLTKKKKKRKRMPPERVEKIMDQIEKYIMTRLYKYVFCPE
TTDDEKKDLAVQKRIRALHWVTPQMLCVPVNEEIPEVSDMVVKAITDIIEMDSKRVPRDK
LACITKCSKHIFNAIKITKDEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRL
MSGEDGYYFTNLCCAVTFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQESENWSPDACLGV
KQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAKKVQDIVEKCPLEIKPPNQSL
AAIDSENVENDKLPPPLQPQVYAG
Download sequence
Identical sequences G1NTP5
ENSMLUP00000000550 ENSMLUP00000000550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]