SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000573 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000573
Domain Number 1 Region: 1068-1207,1286-1553
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-109
Family Myotubularin-like phosphatases 0.00000546
Further Details:      
 
Domain Number 2 Region: 1607-1810
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-30
Family Pleckstrin-homology domain (PH domain) 0.0000243
Further Details:      
 
Domain Number 3 Region: 839-980
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-17
Family GRAM domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000573   Gene: ENSMLUG00000000610   Transcript: ENSMLUT00000000631
Sequence length 1813
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429828:4035297:4231463:1 gene:ENSMLUG00000000610 transcript:ENSMLUT00000000631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCQPSGWQLSRERKQPTFFVVVLTDIDSDRHYCSCLTFYEAEINLQEVLYPDNVAGTKKE
EIEGEVEVTGLIQPAEVFAPKSLVLVSRLYYPEIFRACLGLIYTVYVDSLNVSLESLIAN
LCACLVPAAGGSQKLFSLGAGDRQLIQTPLHDSLPVTGASVALLFQQLGIQNVLSLFCAV
LTENKVLFHSSSFQRLNDACRALESLMFPLKYSYPYIPILPAQLLEVLSSPTPFIIGVHS
IFKTDVHELLDVIIADLDGGTIKIPECIHLSSLPEPLLHQTQAALSLILHPDLEVADHAF
PPPRTALSHSKMLDKEVRAVFLRLFAQLFQGYRSCLQLIRIHAEPVIHFHKTAFLGQRGL
VENDFLTKVLNGMAFAGFVSERGPPYRSCDLFDELVAFEVERIKVEENNPLKMIKHVREL
AEQLFKNENPNPHMAFQKVPRPTEGSHLRVHILPFPKINETRVQELIQENLAKNQNAPPA
SRVDKKCVVPAGPPVVSIMDKVKTVFNSAQRLEVVRNCISFIFENKTLETEKTLPAALRA
LKGKAARQCLTDELGLHVQQNRAILDHQQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLT
SAFYRKLAPGVSQFAYTCVQDHPIWTNQQFWETTFYNAVQEQVRSLYLSAKSPSLSPRLD
TGETDKIPDDQYQEKTAMDLAAEQLRLWPTLSKSTQQELVQREESIVFSQAIHFANLMVN
LLVPLDTSKNKLLRTSAPGDWESGSNSIVTNSIAGSVAESYDTESGFEDSENNDIANSVV
RFITRFIDKVCTESGVTQDHIKSLHCMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRP
ALLPGEEIVCEGLRVLLDPDGREEATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLV
GEQTVMRSFPIASITKEKKITMQNQLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIF
KKQLMKFRYPQSIFTTFAFATGQTTPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIG
RQYLLKKRTGTIVEERVSRPGWNEEDDISVSDESELPTSTTLKASEKSTMEQLVEKACFR
DYQRLGLGTISGSSSRSKPEYFRITASNRMYSLCRSYPGLLVVPQAVQDSSLPRVARCYR
HNRLPVVCWKNSRSGTLLLRAGGFHGKGVVGLFKSQNSPQAAPTSSLESSNSIEQEKYLQ
AILSAVSVHQKLRGNNTLTKFTWSHSGSKGVWASLRSSTRLISSPTSFIDVGARLAGKDH
SASYSNSAYLQNQLLKRQPALYIFGEKSQLRNFKLEFALNCEFVPVEFHDIRQVKASFKK
LMRACVPSTIPTDSDVTFLKALGDSEWFPQLHRIMQLAVVVSEVLENGSSVLVCLEEGWD
ITAQVTSLVQLLSDPFYRTLEGFRMLVEKEWLSFGHKFSQRSSLTLNCQGSGFTPVFLQF
LDCVHQVHNQYPTEFEFNLYYLKFLAFHYVSNRFKTFLLDSDYERLEHGTLFDDKGDKHA
KKGLCIWECVDRMHKRSPIFFNYLYSPVEIEALKPNVNVSSLKKWDYYIEETLSTGPSYD
WMMLTPKQFPPEDCDLAGGAGPQSQRRTVWPCYDDISCTQPDALTSLFSEIERLEHKLNQ
TPEKWQQLWERVAVDLKEEPRADRPQRHPPGSPGMVSTNLPPYQKRSLLHLPDSVAEEQS
ASISPSNGVDRRAATLYSQYTSKNDENRSFEGTLYKRGALLKGWKPRWFVLDVTKHQLRY
YDSGEDTSCKGHIDLAEVEMVLPAGPSMGAPKHTSDKAFFDLKTSKRVYNFCAQDGQSAQ
QWMDRIQSCISDA
Download sequence
Identical sequences G1NTR4
ENSMLUP00000000573 ENSMLUP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]