SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000577 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000577
Domain Number 1 Region: 975-1070
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-25
Family PDZ domain 0.0000811
Further Details:      
 
Domain Number 2 Region: 839-934
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-25
Family PDZ domain 0.00017
Further Details:      
 
Domain Number 3 Region: 302-409
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-23
Family PDZ domain 0.0000258
Further Details:      
 
Domain Number 4 Region: 673-773
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-23
Family PDZ domain 0.00037
Further Details:      
 
Domain Number 5 Region: 466-579
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.00022
Further Details:      
 
Domain Number 6 Region: 150-190
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000742
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 1-49
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000106
Family Nucleotide and nucleoside kinases 0.0035
Further Details:      
 
Domain Number 8 Region: 208-247
Classification Level Classification E-value
Superfamily WW domain 0.000000000556
Family WW domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000577   Gene: ENSMLUG00000000633   Transcript: ENSMLUT00000000635
Sequence length 1328
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429822:1544504:1648943:1 gene:ENSMLUG00000000633 transcript:ENSMLUT00000000635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITT
DALQSLHSGSKQSTPKRTKSYNDMQNAGLVHAELEEDDGPEMNSSFTADSADQEEHSLQE
ATLPPVNSSLIAAPITDPSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKT
TSWLDPRCLSKQQKPLEECEDDEEGVHTEELDSELELPAGWEKIEDPVYGIYYVDHINRK
TQYENPVLEAKRKKQLEQPPPQPQPQPPSEAEWTEDRSSLVPPAIPSHPPSNPEPARDPP
LQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGDEPDEFLQIKSLVLDGPAALDGK
METGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPFDPDDPNTSLVTS
VAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNGSHGYPNDTVSLA
SSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKK
NVQALTHNQVVDMLIECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVASH
RSLHTASPSHSTQVLPEFPPAEAPAAEQTDSSGQKKPDPFKIWAQSRSMYESRPMSPSPA
SGLSKGEREREISSTNFGECQIPDYQEQDIFLWRKETGFGFRILGGNEPGEPIYIGHIVP
LGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQAAKQGHVNLTVRRKVVFSAPKA
EPEVPSPASSHHSSTQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIGSGGGGGSGVGSA
LQPYDVEIRRGDSEGFGFVIVSSVSRPEAGTTFGRIIEGSPADRCGKLKVGDRILAVNGC
SITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGAQET
RNTTKPKPESQFEFKAPQATQEQDFYTVDLERGAKGFGFSLRGGREYNMDLYVLRLAEDG
PAERCGKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLSLKRGDGSVPEYGGSNY
ENLPSLMPSAVTCAPDNLPSTPFHRSGDATFKRSSSPSLHKRSSHCYLRTRSPPPGAAGE
PGRAPSEHHTWNGTSQPGGGACHPQDRAPEGRREAPPERLAADGPGRRAPERRREGTRSA
DNTLERREKPERRREASPRRRERSPGRRREGSPGRRRRSLERLLEQRRSPERRRPGSPDR
RAKSTDRRRARSPERRRERSLEKRNREDRAGHRERDEGSLRPEGGRGGRHPPEQRRRPYK
ECSTDLSI
Download sequence
Identical sequences G1NTR8
ENSMLUP00000000577 ENSMLUP00000000577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]