SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000699 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000000699
Domain Number - Region: 500-623
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family IMD domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000699   Gene: ENSMLUG00000000761   Transcript: ENSMLUT00000000766
Sequence length 710
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430051:128589:160225:1 gene:ENSMLUG00000000761 transcript:ENSMLUT00000000766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSADGEHLNEPFVADEYIERLVWRTPGGGSRGGSEAFDPKRLLEEFVNHIQELQIMDERI
QRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGV
NTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSD
VKSKIASKYHDLECQLIQEFTSAQKKGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGA
YMRNDIFEDAAILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKDQLEECRKSDA
EQYLKNLYDLYTRKRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVEIGYLK
SRSAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVN
LLQETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNA
NLYFLDVVHQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDR
TLNCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKN
VDTVLMEFGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPLVLQLFDTLH
ALCNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS
Download sequence
Identical sequences G1NU21
ENSMLUP00000000699 ENSMLUP00000000699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]