SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000703 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000703
Domain Number 1 Region: 112-170
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000177
Family RING finger domain, C3HC4 0.0092
Further Details:      
 
Domain Number 2 Region: 46-110
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000353
Family IBR domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000703   Gene: ENSMLUG00000000770   Transcript: ENSMLUT00000000770
Sequence length 250
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429824:6299075:6334326:1 gene:ENSMLUG00000000770 transcript:ENSMLUT00000000770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDASTKPCPQCKHF
TTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHEGVNCKEYKKGDKLLRHWASE
IEHGQRNAQKCPKCKIHIQRTEGCDHMTCSQCNTNFCYRCGERYRQLRFFGDHTSNLSIF
GCKYRYLPERPHLRRFVRGSVCAGKLFVAPLILVLGLALGAIAVVIGLFVFPIYCLCKKQ
RKRSRTGMHW
Download sequence
Identical sequences G1NU25
XP_006778502.1.95426 XP_014311733.1.53796 ENSMLUP00000000703 ENSMLUP00000000703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]