SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000739 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000000739
Domain Number - Region: 8-70
Classification Level Classification E-value
Superfamily GAT-like domain 0.0199
Family GAT domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000739   Gene: ENSMLUG00000000808   Transcript: ENSMLUT00000000807
Sequence length 154
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430564:194662:199903:1 gene:ENSMLUG00000000808 transcript:ENSMLUT00000000807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFEEIHEVMARYKTLVSMHQDLMQSAQEGQEKIERAKARLARYMEEKDDEILQHNNELAR
LQMRFDRARSDVIIWESRWAHIQNTAAKKTLLLGTIKMATLNLFQIVSKQLKETTFVSLE
DTHKQLDMVQQFIQDLSDIWAEVKKKDQTPQIRV
Download sequence
Identical sequences G1NU57
ENSMLUP00000000739 ENSMLUP00000000739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]