SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000742 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000742
Domain Number 1 Region: 150-237
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000196
Family cAMP-binding domain 0.08
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000000742
Domain Number - Region: 62-117
Classification Level Classification E-value
Superfamily Taf5 N-terminal domain-like 0.051
Family Taf5 N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000742   Gene: ENSMLUG00000000811   Transcript: ENSMLUT00000000809
Sequence length 291
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430107:994845:998625:-1 gene:ENSMLUG00000000811 transcript:ENSMLUT00000000809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNSTVWKDLIDEHPVCTHWKQEAEGAIYHLASIFLVVGLMGGSGFFGLLYVFSLLGLG
FLCTAIWAWVDVCAADIFSWHFVLFIICFVQFVHIAYQVRSITFAREFQLMYSSIFQPLG
TPVPVFRMIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPFQF
LDSPEWDSLRPTEEGTFQVTLTAETDCRYVSWRRKKLYLLFAQYRYISRLFSVLIGSDIA
DKLYALNDRVYIGRRYHYDIRLPNFYQLAGPEKPRSPLIRHFRNSRQHCDK
Download sequence
Identical sequences G1NU60
XP_006101143.1.53796 ENSMLUP00000000742 ENSMLUP00000000742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]