SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000775 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000775
Domain Number 1 Region: 6-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.66e-72
Family BAR domain 0.000000000615
Further Details:      
 
Domain Number 2 Region: 479-633
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-27
Family Phosphotyrosine-binding domain (PTB) 0.0098
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-22
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000000775
Domain Number - Region: 620-666
Classification Level Classification E-value
Superfamily Gam-like 0.0379
Family Gam-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000775   Gene: ENSMLUG00000000842   Transcript: ENSMLUT00000000847
Sequence length 708
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429850:4222744:4252112:1 gene:ENSMLUG00000000842 transcript:ENSMLUT00000000847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIDKLPIEETLEDSPQTRSLLGVFEEDATAISNYMNQLYQAMHRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQLADAMMFPITQFKE
RDLKEILTLKEVFQIASNDHDAAIHRYSRLSKKRENDKAKYEVTEDVYTSRKKQHQTMMH
YFCSLNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLTNIGTSVQNVRREM
DSDVETMQQTIEDLEIASDPLYVPDPDPTKFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMSQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPVGQSRPS
TARTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVSEDQPGQGKASGQGGRRTNP
FGESGGGTKSETEDSILHQLFIVRFLGSMEVKSDDNPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLTFPLPSVVLYATHQENKRLFGFVLRTSGGRSESHLSS
VCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEEGKKRESEA
Download sequence
Identical sequences G1NU89
XP_006090930.1.53796 ENSMLUP00000000775 ENSMLUP00000000775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]