SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000783 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000783
Domain Number 1 Region: 57-420
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.75e-63
Family Ankyrin repeat 0.0000376
Further Details:      
 
Domain Number 2 Region: 521-573
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000366
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000783   Gene: ENSMLUG00000000859   Transcript: ENSMLUT00000000856
Sequence length 584
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429850:4260741:4276977:-1 gene:ENSMLUG00000000859 transcript:ENSMLUT00000000856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNYTSDEDLDMDFDTQLIIQQSLQDICKPGTAEQAPENESFLSTDCKKIVETIETGEED
ALLHLTKYGSAFDEADEIGRLPLHKAAVQLNTNILEITLKASKPSVWEQTTHNGETPLFL
AVSNCLLENATFLLLNGCNPNAKNFEGNSPLLTAVLHDSYDMASLLIRHGADVNLQCANE
RTALHEAARLGRRDLVKLMLVSGAHPDPQSSYGFTPLALAAQSGHTEIMEILLQKGANAR
GQASDSSSILLEAASGGNPDSVTLLLEYGADANVPKNSGHLPIHVAADRGHLLALKILIP
VTNFAAIKRSGISPVHCAAAGAHPECLELLIQAGFDVNFMLDQRIRKHYDDQRKSALYFA
VSNGDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCKVNPLHF
PSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHRIYDFEGWTSTVIKDTLFCEVIT
LSWLQHLSGKVVRIMLDYVDQVRICSKLKAVLQKQRLWSEIHNILTNPRSLKHLCRLKIR
KCMGRLHLRCPVFMSFLPLPNRLKAYVLYKEYDLYGEGIFTGTW
Download sequence
Identical sequences G1NU97
ENSMLUP00000000783 ENSMLUP00000000783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]