SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000788 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000788
Domain Number 1 Region: 30-123
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.84e-30
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 
Domain Number 2 Region: 252-362
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-20
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 3 Region: 134-232
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000217
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000788   Gene: ENSMLUG00000000860   Transcript: ENSMLUT00000000861
Sequence length 382
Comment pep:novel scaffold:Myoluc2.0:GL431056:33607:56513:-1 gene:ENSMLUG00000000860 transcript:ENSMLUT00000000861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQRAHRPGRPALVSSPSSPPSPAAALSPADPDWASYKLGVFICLNCSGVHRNFPDISKV
KSLRLDFWDDSVVEFMTHNGNLRVKAKYEARVPAFYYIPQASDCLVLKEQWIRAKYERQE
FMADGKTISLSGNREGFLWKRGRDNAQFLRRRFVLLAREGLLKYYTKEEAGSAKKGNSIH
IKDLNATFQTEKIGNPHGLQITYRREGHIRNLFVYHESGKEIVDWFNALRAARLQYLKAA
FPELPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALDPQERRLLYYKNPLDAFDL
GQVFLGSREQGYEVSEGLPKNVQGNRWKAGLTIVTPERRFLFTCPSEKEQGEWLESFRDV
LSRPLTSFNLLTASTESGHSSR
Download sequence
Identical sequences G1NUA1
ENSMLUP00000000788 ENSMLUP00000000788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]