SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000832 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000832
Domain Number 1 Region: 124-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-90
Family Nuclear receptor ligand-binding domain 0.00000000169
Further Details:      
 
Domain Number 2 Region: 21-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000832   Gene: ENSMLUG00000000912   Transcript: ENSMLUT00000000911
Sequence length 427
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429858:2026734:2064865:-1 gene:ENSMLUG00000000912 transcript:ENSMLUT00000000911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPRLSEEQQRIITILLDAHHKTYDPTYADFSQFRPPVRGPEGGDSHLSKSSLRHMPSFSG
DSSSSCSDQYTGSPDLMEPTNFSNLDLSEENSDSSSVTLDLSHLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTAEDQIVLLKSSAIEVIMLRSNQSFTMDDMSWTCGAEDYKYRISDV
TKAGHSLDLIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
Download sequence
Identical sequences G1NUD9
ENSMLUP00000000832 ENSMLUP00000000832 XP_006091535.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]