SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000855 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000855
Domain Number 1 Region: 346-666
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-93
Family Protein kinases, catalytic subunit 0.000000000434
Further Details:      
 
Domain Number 2 Region: 2-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.51e-24
Family PLC-like (P variant) 0.00000127
Further Details:      
 
Domain Number 3 Region: 217-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000922
Further Details:      
 
Domain Number 4 Region: 142-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.98e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000855   Gene: ENSMLUG00000000929   Transcript: ENSMLUT00000000936
Sequence length 676
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429850:760424:772987:1 gene:ENSMLUG00000000929 transcript:ENSMLUT00000000936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRIAFNTYELGSLQAADEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPISEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLIPVQY
FLEDGNCKQSLRGEDESMFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALNQVSQKTPR
KPETESAEPFGIYQNFEKKLELMGNFSLADSGTYGKIWEGSSKCKIEHFTFHKVLGKGSF
GKVLLAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLYCTFQTK
EHLFFVMEFLNGGDLMYHIQDKGRFELYRAMFYAAEIICGLQFLHSKGIIYRDLKLDNVM
LDQNGHIKIADFGMCKENIIAEKKASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLLERDPAKRLGVTGNIKTH
PFFKTINWTLLEKRQVEPPFKPKVKSPGDYSNFDQDFLNEKPRLSYSDKNLIDSMDQTAF
SGFSFINPKFERLLEN
Download sequence
Identical sequences G1NUF9
ENSMLUP00000000855 ENSMLUP00000000855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]