SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000876 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000876
Domain Number 1 Region: 31-149
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-44
Family Dcp1 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000876   Gene: ENSMLUG00000000956   Transcript: ENSMLUT00000000959
Sequence length 598
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429850:825044:871760:-1 gene:ENSMLUG00000000956 transcript:ENSMLUT00000000959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAPSCPRLRPLQRGSAREFKMESLSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCP
KANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNA
SLSIYSIWFYDKNDCHRIAKLMSEVVEEETRRSQQAARDKQSPSQANGCSEHRPIDILEM
LSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEETPSGLQDKSAPSGHKHLTVE
ELFGTSLPKEQPTVVGLDSEEVEKLPGDAPQKELSSFLPFSFEQSGGTPRSENPGAHPAA
HHSAQPEVTAPVLITPASISQSSEKQLPSYAIPLHPGLSPTLPAEAPTVQVPPCLPRNTT
MMQAVKTTPRQRSPLLGQSVPELSHASLTASQSPFRAPLSVTNTAGTTLPSVDLLQKLRL
TPQHDQIQTQSLGKGAVAPSFPPAAGQLATPESFIEPPPKTAAARASTALSNMVLAPPQV
LQEGGALTEWGELERPYAFIDAVGPPLVTTAVVSSVLLSPSVFQQTVTRATDLERKASSP
SPLTVGTSENQRKPSIILSKSQLQDTLIHLIKNDSGFLSTLHEVYLQVLTKNKDNHNL
Download sequence
Identical sequences G1NUH5
ENSMLUP00000000876 ENSMLUP00000000876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]