SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000910 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000910
Domain Number 1 Region: 88-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-24
Family Regulator of G-protein signaling, RGS 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000910   Gene: ENSMLUG00000001001   Transcript: ENSMLUT00000000997
Sequence length 160
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429784:10113449:10119092:1 gene:ENSMLUG00000001001 transcript:ENSMLUT00000000997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSERREMQKRQMSAAQETSDSLPGQHGVGNRGSNACCFCWCCCCSCSCLTVRNQEQGPA
RASHELRRDDLPTWEERSLQSPTPTLEEVSAWAQSFDKLMLTPAGRNAFREFLRTEFSED
NMLFWMACEELKKEANKSIIEEKARTIYEDYISILSPKEV
Download sequence
Identical sequences G1NUK7
ENSMLUP00000000910 ENSMLUP00000000910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]