SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000940 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000940
Domain Number 1 Region: 243-523
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000158
Further Details:      
 
Domain Number 2 Region: 3-105
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-28
Family SH2 domain 0.0000096
Further Details:      
 
Domain Number 3 Region: 93-213
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-26
Family SH2 domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000940   Gene: ENSMLUG00000001028   Transcript: ENSMLUT00000001029
Sequence length 594
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:8348587:8358044:1 gene:ENSMLUG00000001028 transcript:ENSMLUT00000001029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPRWFHRDLSGLDAETLLKGRGVHGSFLARPSRKNQGDFSLSVRVGDQVTHIRIQNSGDF
YDLYGGEKFATLTELVEYYTQQHGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQA
ETLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKIMCEGGRYTVGG
SETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQDSENTA
KAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPGSD
YINANYIKNQLLGPDENSKTYIASQGCLEATVNDFWQMTWQENTRVIVMTTREVEKGRNK
CVPYWPEVGTQRVYGSYTVTSCGEHDTAEYKLRTLQVSPLDNENLVRDIWHYQYLSWPDH
GVPSEPGGVLSFLDQINNRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESITTKGLDC
DIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEVMQSQKGQESEYGNIS
YPSAMKNTHAQAFRTSSKHKEDVYENLHKSKKEEKVKKQRSADKDKSKGSLKKK
Download sequence
Identical sequences G1NUN4
ENSMLUP00000000940 ENSMLUP00000000940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]