SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000975 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000975
Domain Number 1 Region: 359-681
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.8e-81
Family Ankyrin repeat 0.00000399
Further Details:      
 
Domain Number 2 Region: 5-246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-56
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000975   Gene: ENSMLUG00000001069   Transcript: ENSMLUT00000001066
Sequence length 701
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430528:57960:82803:1 gene:ENSMLUG00000001069 transcript:ENSMLUT00000001066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XKTWLAIQCSPSHVDDRERLELLEEAKKMEMAKFRYILPVYGICRDPVGLVMEFMETGSL
EKLLASEPLPWDLRFRIIHETAVGMNFLHCMSPPLLHLDLKPANILLDAHYHVKISDFGL
AKCNGLSHSHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFA
DEKNILHIMVKVVKGHRPELPPVCRARPRACSHLLRLMQRCWHGDPRERPTFQEITSETE
DLCEKPDDEVKEATQDLDVKDPPEPKTEAPVSTPPQASLGPRPSTKDYSLSELLSKLDSG
ISQTLEARTSSAAAPPESKLPSGDSGQRSGVSTVDSAFSSRGSLSLNQTDHFFLSLSILF
LFSYWSWRECVQWLLLHDAIPNLTNRKGSTPLHLAVEKRVRGVVELRLARKISVNATDED
QWTALHFAAQNGDECSTRLLLEKNASINEADCEGRTPMHVACQHGQESVVRILLRRGVDV
GLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARIL
IDLHSDVNLCNLLEQTPLHVAAETGHTSTARLLLHRGASREAVTAEGCTALHLASRNGHL
ATVKLLVEEKANVLARGPRNQTALHLAAASGHSEVVEELVSADVLNLSDEQGLSALHLAA
RGRHAKTVETLLKHGAHVNLQSLKFQGSHSPAATLLRRSKT
Download sequence
Identical sequences G1NUR6
ENSMLUP00000000975 ENSMLUP00000000975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]