SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001012
Domain Number 1 Region: 124-190
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-19
Family SH3-domain 0.00085
Further Details:      
 
Domain Number 2 Region: 382-444
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-18
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 185-249
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-16
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 4 Region: 8-69
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000683
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001012   Gene: ENSMLUG00000001112   Transcript: ENSMLUT00000001107
Sequence length 733
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429795:986476:1078894:-1 gene:ENSMLUG00000001112 transcript:ENSMLUT00000001107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLTLLDLLECPVCLEKLDVTAKVLPCQHTFCKPCLQRISKAHKGLRCPECRTLVFGSI
EALPANLLLVRLLDGVRSGPSSGRGGSFRRPGVLALQDGRKSRTHPRGLQASPFRLVPNI
RIHMDGVPRAKALCNYRGQNPGDLRFNKGDVILLRRQLDENWYQGEINGVSGFFPASSVE
VIKQLPQPPPLCRALYNFDLRNKDKNDNQDCLTFLKDDIITVISRVDENWAEGKLGDKIG
IFPILFVEPNLTAKHLLEKNKGRHPSRTKSLSLVSSSRGKATNTPSLRRGPGSRRKGPGQ
LSITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVISQHVEKADVLPSSLGQVSMYH
ATPASPGHSMAIVSLPGSQQHLSANMFVALHSYSAHGPDELDLQRGEGIRVLGKYQDGWL
KGVSLVTGRVGIFPNNYVIPIFRTISTPRKTSSFPDPRSPGLYATWTLSTSSVSSQGSIS
EGDPRQSRPFKSVFVPTAIVNPVRSTASLGTSGQSTLRKGRGSMRKNGSLQRPVPSGIPT
LVVGSLRRSPTMVVRPQQFQFHQPQAVPSSPLMVVAEMGPKPTPTGEPALTCISRGSESR
IHSTASSIIMEGKEIPIKSEPPLKPPASAPPSILVKPENSRNSSEKQVKTVRFQNYSPPP
AKHSTSGKPEHPATPKGSQPEATPLGPEMTILFAHRSGCHSGQQTDPRRKSAFSKTAAPV
SSASATQTMFPSK
Download sequence
Identical sequences G1NUU6
ENSMLUP00000001012 ENSMLUP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]