SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001037 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001037
Domain Number 1 Region: 525-653
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-16
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001037
Domain Number - Region: 85-246
Classification Level Classification E-value
Superfamily ARM repeat 0.00057
Family PBS lyase HEAT-like repeat 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001037   Gene: ENSMLUG00000001134   Transcript: ENSMLUT00000001135
Sequence length 711
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430041:676347:680771:1 gene:ENSMLUG00000001134 transcript:ENSMLUT00000001135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRDVVKIAVQKRDAIPQLIQLDQAKPLAAVLKEVCDAWSLAHSERYALQFADGHKRY
ITESNRSEIKNGSILCLSTAPDLEAEQLLGVLESRSREGRREALQHLVLLAPDMTFAQEV
ISREGLQKLGTIIEEGDDLGEELALALQVFLELMEHGVVSWETLSIPFVKKVIRYVNMNL
MDPSVQPLALRLLESVTLSSPTLGQVVKSEVPLDRLLVHLQVMALLTALLQGASPVDRKH
MLDYLWQRNLRQFIYKSIIHSAAPLGDEMAHHLYVLQSLTLGLLEQRMRTPLDPYSQEQR
EQLQTLRQAAFELEGESPSAGLSADRRRSLCAREFRKLGFTNSNPAQDLERVPPGLLALD
NMLYFSKHAPSAYSRFVLENSSREDKHECPFARSSIQLTVLLCELLRVGEPCSETAQDFS
PMFFSQDQSFHELFCVSIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLALKPSSLELF
RTKVNALTYAEVLRLRQTERLHQEVTLAPPILELREKLKPELMGLIRQQRLLRLCEGTLF
RKISSRRRQDKLWFCCLSPNHKVLQYGDVEDGASPPAPESLPEQLPVADLRALLTGKDCP
HVREKGSLKQNKDLCELAFSVSYDHGEEEAYLNFIAPSKQEFHLWTDGLSTLLGSPMGSE
QTRLDLEQLLTMETKLRLLELENVPIPEQPPPIPPPPTNFNFCYDCSVTEP
Download sequence
Identical sequences G1NUW6
ENSMLUP00000001037 ENSMLUP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]